RAVER1 Rabbit Polyclonal Antibody

CAT#: TA343977

Rabbit Polyclonal Anti-RAVER1 Antibody


USD 485.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of ribonucleoprotein, PTB-binding 1 (RAVER1)
    • 100 ug

USD 665.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Purified recombinant protein of Homo sapiens ribonucleoprotein, PTB-binding 1 (RAVER1), 20 µg
    • 20 ug

USD 867.00

Other products for "RAVER1"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RAVER1 antibody: synthetic peptide directed towards the N terminal of human RAVER1. Synthetic peptide located within the following region: VTHRPPLSPKSGAEVEAGDAAERRAPEEELPPLDPEEIRKRLEHTERQFR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 67 kDa
Gene Name ribonucleoprotein, PTB binding 1
Background RAVER1 contains 3 RRM (RNA recognition motif) domains. It cooperates with PTBP1 to modulate regulated alternative splicing events and promotes exon skipping. It cooperates with PTBP1 to modulate switching between mutually exclusive exons during maturation of the TPM1 pre-mRNA.
Synonyms KIAA1978
Note Immunogen Sequence Homology: Human: 100%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Dog: 79%; Pig: 79%; Guinea pig: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.