RBM48 Rabbit Polyclonal Antibody

SKU TA343949

Rabbit Polyclonal Anti-DKFZP564O0523 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DKFZP564O0523 antibody: synthetic peptide directed towards the C terminal of human DKFZP564O0523. Synthetic peptide located within the following region: FLQTNPTGNEIMIGPLLPDISKVDMHDDSLNTTANLIRHKLKEVISSVPK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 42 kDa
• Gene Name: RNA binding motif protein 48
• Database Link:
  NP_115496
  Q5RL73
• Background: The exact functions of DKFZP564O0523 remain unknown.
• Synonyms: C7orf64; HSPC304; MGC16142
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 86%; Mouse: 86%; Guinea pig: 86%; Zebrafish: 83%

Reference Data