UPF3A Rabbit Polyclonal Antibody

SKU TA343923

Rabbit Polyclonal Anti-UPF3A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-UPF3A antibody: synthetic peptide directed towards the middle region of human UPF3A. Synthetic peptide located within the following region: QRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKKGSQDSGAPG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 55 kDa
• Gene Name: UPF3 regulator of nonsense transcripts homolog A (yeast)
• Database Link:
  NP_075387
  Q9H1J1
• Background: UPF3A is part of a multiprotein post-splicing mRNP complex involved in both mRNA nuclear export and mRNA surveillance. UPF3A is involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Binds spliced mRNA upstream of exon-exon j
• Synonyms: HUPF3A; RENT3A; UPF3
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data