OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

UPF3A Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA343923
Rabbit Polyclonal Anti-UPF3A Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY409111 Transient overexpression lysate of UPF3 regulator of nonsense transcripts homolog A (yeast) (UPF3A), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP304333 Recombinant protein of human UPF3 regulator of nonsense transcripts homolog A (yeast) (UPF3A), transcript variant 2, 20 µg
20 ug
$737.00

View other "UPF3A or NM_023011" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-UPF3A antibody: synthetic peptide directed towards the middle region of human UPF3A. Synthetic peptide located within the following region: QRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKKGSQDSGAPG
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 55 kDa
Gene Name UPF3 regulator of nonsense transcripts homolog A (yeast)
Database Link
Background UPF3A is part of a multiprotein post-splicing mRNP complex involved in both mRNA nuclear export and mRNA surveillance. UPF3A is involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Binds spliced mRNA upstream of exon-exon j
Synonyms HUPF3A; RENT3A; UPF3
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products