CWC22 Rabbit Polyclonal Antibody

SKU TA343901

Rabbit Polyclonal Anti-KIAA1604 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KIAA1604 antibody: synthetic peptide directed towards the C terminal of human KIAA1604. Synthetic peptide located within the following region: RSKSKEMNRKHSGSRSDEDRYQNGAERRWEKSSRYSEQSRESKKNQDRRR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 105 kDa
• Gene Name: CWC22 homolog, spliceosome-associated protein
• Database Link:
  NP_065994
  Q9HCG8
• Background: KIAA1604 may be involved in pre-mRNA splicing.
• Synonyms: EIF4GL; fSAPb; NCM
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Horse: 93%; Dog: 86%; Bovine: 86%; Guinea pig: 86%; Rat: 83%; Mouse: 83%

Reference Data