TMEM63B Rabbit Polyclonal Antibody

CAT#: TA343879

Rabbit Polyclonal Anti-TMEM63B Antibody

Product Images

WB Suggested Anti-TMEM63B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMEM63B antibody: synthetic peptide directed towards the middle region of human TMEM63B. Synthetic peptide located within the following region: VRGCEQVEAIEYYTKLEQKLKEDYKREKEKVNEKPLGMAFVTFHNETITA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 95 kDa
• Gene Name: transmembrane protein 63B
• Database Link:
  NP_060896
  Entrez Gene 55362 Human
  UniProt ID Q5T3F8
• Background: TMEM63B belongs to the SPO75/TMEM63 family. It is a multi-pass membrane protein. The function of TMEM63B remains unknown.
• Synonyms: C6orf110
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%

Reference Data

• Protein Families: Transmembrane