RG9MTD1 (TRMT10C) Rabbit Polyclonal Antibody

SKU TA343861

Rabbit Polyclonal Anti-RG9MTD1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RG9MTD1 antibody: synthetic peptide directed towards the middle region of human RG9MTD1. Synthetic peptide located within the following region: KKARQIKKEMKAAAREEAKNIKLLETTEEDKQKNFLFLRLWDRNMDIAMG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 47 kDa
• Gene Name: tRNA methyltransferase 10C, mitochondrial RNase P subunit
• Database Link:
  NP_060289
  Q7L0Y3
• Background: RG9MTD1 functions in mitochondrial tRNA maturation. Part of mitochondrial ribonuclease P, an enzyme composed of MRPP1/RG9MTD1, MRPP2/HSD17B10 and MRPP3/KIAA0391, which cleaves tRNA molecules in their 5'-ends.
• Synonyms: COXPD30; HNYA; MRPP1; RG9MTD1
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 93%

Reference Data