RG9MTD1 (TRMT10C) Rabbit Polyclonal Antibody

SKU
TA343860
Rabbit Polyclonal Anti-RG9MTD1 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RG9MTD1 antibody: synthetic peptide directed towards the middle region of human RG9MTD1. Synthetic peptide located within the following region: MKRKELQNTVSQLLESEGWNRRNVDPFHIYFCNLKIDGALHRELVKRYQE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 47
Gene Name tRNA methyltransferase 10C, mitochondrial RNase P subunit
Database Link
Background RG9MTD1 functions in mitochondrial tRNA maturation. Part of mitochondrial ribonuclease P, an enzyme composed of MRPP1/RG9MTD1, MRPP2/HSD17B10 and MRPP3/KIAA0391, which cleaves tRNA molecules in their 5'-ends.
Synonyms COXPD30; HNYA; MRPP1; RG9MTD1
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Horse: 93%; Pig: 92%; Guinea pig: 92%; Bovine: 86%; Rabbit: 86%; Zebrafish: 85%; Dog: 79%
Reference Data
Write Your Own Review
You're reviewing:RG9MTD1 (TRMT10C) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.