RRP7A Rabbit Polyclonal Antibody

CAT#: TA343833

Rabbit Polyclonal Anti-CTA-126B4.3 Antibody

Product Images

WB Suggested Anti-CTA-126B4.3 Antibody Titration: 0.2-1 ug/ml; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CTA-126B4.3 antibody: synthetic peptide directed towards the N terminal of human CTA-126B4.3. Synthetic peptide located within the following region: NVPPYCTEESLSRLLSTCGLVQSVELQEKPDLAESPKESRSKFFHPKPVP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: ribosomal RNA processing 7 homolog A
• Database Link:
  NP_056518
  Entrez Gene 27341 Human
  UniProt ID Q9Y3A4
• Background: The exact function of CTA-126B4.3 remains unknown.
• Synonyms: BK126B4.3; CGI-96
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Pig: 92%; Mouse: 92%; Bovine: 92%; Dog: 83%; Rabbit: 83%; Guinea pig: 75%