RBM34 Rabbit Polyclonal Antibody

SKU TA343823

Rabbit Polyclonal Anti-RBM34 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RBM34 antibody: synthetic peptide directed towards the C terminal of human RBM34. Synthetic peptide located within the following region: SKPKQGLNFTSKTAEGHPKSLFIGEKAVLLKTKKKGQKKSGRPKKQRKQK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 48 kDa
• Gene Name: RNA binding motif protein 34
• Database Link:
  NP_055829
  P42696
• Background: RBM34 belongs to the RRM RBM34 family. It contains 2 RRM (RNA recognition motif) domains. The function of the RBM34 protein remains unknown.
• Synonyms: KIAA0117
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Horse: 86%; Rat: 76%

Reference Data