TMEM63A Rabbit Polyclonal Antibody

SKU TA343815

Rabbit Polyclonal Anti-TMEM63A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMEM63A antibody: synthetic peptide directed towards the N terminal of human TMEM63A. Synthetic peptide located within the following region: MDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSAKNSTVLQGVTFGGIP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 89 kDa
• Gene Name: transmembrane protein 63A
• Database Link:
  NP_055513
  O94886
• Background: TMEM63A is a multi-pass membrane proteinPotential. It belongs to the SPO75/TMEM63 family. The exact function of TMEM63A remains unknown.
• Synonyms: KIAA0792
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Pig: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%; Yeast: 83%

Reference Data

• Protein Families: Transmembrane