RRP4 (EXOSC2) Rabbit Polyclonal Antibody

CAT#: TA343807

Reviews ()
Write a review

Rabbit Polyclonal Anti-EXOSC2 Antibody



USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-EXOSC2 antibody: synthetic peptide directed towards the N terminal of human EXOSC2. Synthetic peptide located within the following region: RKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 32 kDa
Gene Name exosome component 2
Background EXOSC2 belongs to the exosome, a RNA-processing complex, which is at least involved in the 3' processing of the 7S pre-rRNA to the mature 5.8S rRNA. It exhibits a 3'-5' exoribonuclease activity.
Synonyms hRrp4p; p7; RRP4; Rrp4p
Note Immunogen Sequence Homology: Human: 100%; Rat: 93%; Rabbit: 91%; Dog: 86%; Pig: 86%; Mouse: 86%; Guinea pig: 85%; Horse: 79%; Bovine: 79%
Reference Data
Protein Pathways RNA degradation
Other products for "EXOSC2"
Frequently bought together (3)
Recombinant protein of human exosome component 2 (EXOSC2)
    • 20 ug

USD 748.00


Transient overexpression lysate of exosome component 2 (EXOSC2)
    • 100 ug

USD 360.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 169.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies