RRP4 (EXOSC2) Rabbit Polyclonal Antibody

SKU TA343807

Rabbit Polyclonal Anti-EXOSC2 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EXOSC2 antibody: synthetic peptide directed towards the N terminal of human EXOSC2. Synthetic peptide located within the following region: RKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 32 kDa
• Gene Name: exosome component 2
• Database Link:
  NP_055100
  Q13868
• Background: EXOSC2 belongs to the exosome, a RNA-processing complex, which is at least involved in the 3' processing of the 7S pre-rRNA to the mature 5.8S rRNA. It exhibits a 3'-5' exoribonuclease activity.
• Synonyms: hRrp4p; p7; RRP4; Rrp4p
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Rabbit: 91%; Dog: 86%; Pig: 86%; Mouse: 86%; Guinea pig: 85%; Horse: 79%; Bovine: 79%

Reference Data

• Protein Pathways: RNA degradation