RRP4 (EXOSC2) Rabbit Polyclonal Antibody
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-EXOSC2 antibody: synthetic peptide directed towards the N terminal of human EXOSC2. Synthetic peptide located within the following region: RKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 32 kDa |
Gene Name | exosome component 2 |
Database Link | |
Background | EXOSC2 belongs to the exosome, a RNA-processing complex, which is at least involved in the 3' processing of the 7S pre-rRNA to the mature 5.8S rRNA. It exhibits a 3'-5' exoribonuclease activity. |
Synonyms | hRrp4p; p7; RRP4; Rrp4p |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 93%; Rabbit: 91%; Dog: 86%; Pig: 86%; Mouse: 86%; Guinea pig: 85%; Horse: 79%; Bovine: 79% |
Reference Data | |
Protein Pathways | RNA degradation |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Antibody Resources |
Other products for "EXOSC2"
Customer
Reviews
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.