ZNF281 Rabbit Polyclonal Antibody

SKU
TA343703
Rabbit Polyclonal Anti-ZNF281 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF281 antibody: synthetic peptide directed towards the middle region of human ZNF281. Synthetic peptide located within the following region: PMTFITNSNGEVDHRVRTSVSDFSGYTNMMSDVSEPCSTRVKTPTSQSYR
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 97 kDa
Gene Name zinc finger protein 281
Database Link
Background ZNF281 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 4 C2H2-type zinc fingers. ZNF281 may be involved in transcriptional regulation. It represses the transcription of a number of genes including gastrin and ornithine decarboxylase. ZNF281 binds to the G-rich box in the enhancer region of these genes.
Synonyms ZBP-99; ZNP-99
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families ES Cell Differentiation/IPS, Stem cell - Pluripotency, Transcription Factors
Write Your Own Review
You're reviewing:ZNF281 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.