ELL2 Rabbit Polyclonal Antibody

CAT#: TA343676

Rabbit Polyclonal Anti-ELL2 Antibody

Product Images

WB Suggested Anti-ELL2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: ACHN cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ELL2 antibody: synthetic peptide directed towards the C terminal of human ELL2. Synthetic peptide located within the following region: PGSKEYQNVHEEVLQEYQKIKQSSPNYHEEKYRCEYLHNKLAHIKRLIGE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 72 kDa
• Gene Name: elongation factor for RNA polymerase II 2
• Database Link:
  NP_036213
  Entrez Gene 22936 Human
  UniProt ID O00472
• Background: ELL2 is the elongation factor that can increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by the polymerase at multiple sites along the DNA.
• Synonyms: 2; ELL-related RNA polymerase II; elongation factor; RNA polymerase II
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 85%

Reference Data

• Protein Families: Transcription Factors