SGT1 (ECD) Rabbit Polyclonal Antibody
USD 200.00
USD 867.00
USD 665.00
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ECD antibody: synthetic peptide directed towards the middle region of human ECD. Synthetic peptide located within the following region: VDVDLNLVSNILESYSSQAGLAGPASNLLQSMGVQLPDNTDHRPTSKPTK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 73 kDa |
Gene Name | ecdysoneless cell cycle regulator |
Database Link | |
Background | The exact function of ECD remains unknown. |
Synonyms | GCR2; HSGT1; SGT1 |
Note | Immunogen Sequence Homology: Human: 100%; Horse: 93%; Rabbit: 93%; Pig: 86%; Bovine: 86%; Goat: 79%; Rat: 77% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review