KLF12 Rabbit Polyclonal Antibody

SKU TA343667

Rabbit Polyclonal Anti-KLF12 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KLF12 antibody: synthetic peptide directed towards the N terminal of human KLF12. Synthetic peptide located within the following region: NIHMKRKTIKNINTFENRMLMLDGMPAVRVKTELLESEQGSPNVHNYPDM
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 44 kDa
• Gene Name: Kruppel-like factor 12
• Database Link:
  NP_009180
  Q9Y4X4
• Background: Activator protein-2 alpha (AP-2 alpha) is a developmentally-regulated transcription factor and important regulator of gene expression during vertebrate development and carcinogenesis. KLF12 is a member of the Kruppel-like zinc finger protein family and can repress expression of the AP-2 alpha gene by binding to a specific site in the AP-2 alpha gene promoter. Repression by the encoded protein requires binding with a corepressor, CtBP1.Activator protein-2 alpha (AP-2 alpha) is a developmentally-regulated transcription factor and important regulator of gene expression during vertebrate development and carcinogenesis. The protein encoded by this gene is a member of the Kruppel-like zinc finger protein family and can repress expression of the AP-2 alpha gene by binding to a specific site in the AP-2 alpha gene promoter. Repression by the encoded protein requires binding with a corepressor, CtBP1. Two transcript variants encoding different isoforms have been found for this gene.
• Synonyms: AP-2rep; AP2REP; HSPC122
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 93%; Guinea pig: 93%; Rabbit: 86%

Reference Data

• Protein Families: Transcription Factors