ZNF185 Rabbit Polyclonal Antibody

SKU TA343662

Rabbit Polyclonal Anti-ZNF185 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF185 antibody: synthetic peptide directed towards the N terminal of human ZNF185. Synthetic peptide located within the following region: LAPYNIRRSSTSGDTEEEEEEEVVPFSSDEQKRRSEAASGVLRRTAPREH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 73 kDa
• Gene Name: zinc finger protein 185 (LIM domain)
• Database Link:
  NP_009081
  O15231
• Background: ZNF185 contains 1 LIM zinc-binding domain. The function of ZNF185 remains unknown.ZNF185 encodes a LIM-domain zinc finger protein. These proteins are thought to be involved in protein-protein interactions. [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1276 AY997296.1 1-1276 1277-4307 AK056517.1 347-3377 4308-4312 BQ923456.1 628-632
• Synonyms: SCELL
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 86%; Horse: 79%

Reference Data