RNF113A Rabbit Polyclonal Antibody

CAT#: TA343651

Rabbit Polyclonal Anti-RNF113A Antibody

Product Images

WB Suggested Anti-RNF113A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RNF113A antibody: synthetic peptide directed towards the middle region of human RNF113A. Synthetic peptide located within the following region: LQHFRTTPRCYVCDQQTNGVFNPAKELIAKLEKHRATGEGGASDLPEDPD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: ring finger protein 113A
• Database Link:
  NP_008909
  Entrez Gene 7737 Human
  UniProt ID O15541
• Background: The exact function of RNF113A remains unknown.
• Synonyms: Cwc24; RNF113; TTD5; ZNF183
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Horse: 86%

Reference Data

• Protein Families: Druggable Genome, Protease