BRN3A (POU4F1) Rabbit Polyclonal Antibody

SKU TA343592

Rabbit Polyclonal Anti-POU4F1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-POU4F1 antibody: synthetic peptide directed towards the C terminal of human POU4F1. Synthetic peptide located within the following region: LEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 43 kDa
• Gene Name: POU class 4 homeobox 1
• Database Link:
  NP_006228
  Q01851
• Background: POU4F1 is a class IV POU domain-containing transcription factor highly expressed in the developing sensory nervous system and in cells of the B- and T-lymphocytic lineages.BRN3A (POU4F1) is a class IV POU domain-containing transcription factor highly expressed in the developing sensory nervous system and in cells of the B- and T-lymphocytic lineages (Gerrero et al., 1993). [supplied by OMIM]
• Synonyms: brn-3A; BRN3A; Oct-T1; RDC-1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 92%; Horse: 92%; Bovine: 92%

Reference Data

• Protein Families: Transcription Factors