MEF2B (BORCS8-MEF2B) Rabbit Polyclonal Antibody

CAT#: TA343566

Rabbit Polyclonal Anti-MEF2B Antibody

Product Images

WB Suggested Anti-MEF2B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MEF2B antibody: synthetic peptide directed towards the N terminal of human MEF2B. Synthetic peptide located within the following region: MGRKKIQISRILDQRNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: BORCS8-MEF2B readthrough
• Database Link:
  NP_005910
  Entrez Gene 4207 Human
  UniProt ID Q02080
• Background: This gene represents numerous read-through transcripts that span geneID:729991 and 100271849. Many read-through transcripts are predicted to be nonsense-mediated decay (NMD) candidates, and are thought to be non-coding. Some transcripts are predicted to be capable of translation reinitation at a downstream AUG, resulting in expression of at least one isoform of myocyte enhancer factor 2B (MEF2B) from this read-through locus.
• Synonyms: LOC729991-MEF2B; MEF2B; MEF2BNB-MEF2B
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Sheep: 79%; Rabbit: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Transcription Factors