ER81 (ETV1) Rabbit Polyclonal Antibody

SKU TA343491

Rabbit Polyclonal Anti-ETV1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ETV1 antibody: synthetic peptide directed towards the middle region of human ETV1. Synthetic peptide located within the following region: PDNQRPLLKTDMERHINEEDTVPLSHFDESMAYMPEGGCCNPHPYNEGYV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 55 kDa
• Gene Name: ETS variant 1
• Database Link:
  NP_004947
  P50549
• Background: ETV1 is a transcriptional activator that binds to DNA sequences containing the consensus pentanucleotide 5'-CGGA[AT]-3'.
• Synonyms: ER81
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 86%; Zebrafish: 86%

Reference Data

• Protein Families: ES Cell Differentiation/IPS, Transcription Factors