BLZF1 Rabbit Polyclonal Antibody

SKU TA343420

Rabbit Polyclonal Anti-BLZF1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BLZF1 antibody: synthetic peptide directed towards the N terminal of human BLZF1. Synthetic peptide located within the following region: MTTKNLETKVTVTSSPIRGAGDGMETEEPPKSVEVTSGVQSRKHHSLQSP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 45 kDa
• Gene Name: basic leucine zipper nuclear factor 1
• Database Link:
  NP_003657
  Q9H2G9
• Background: BLZF1 is required for normal Golgi structure and for protein transport from the endoplasmic reticulum (ER) through the Golgi apparatus to the cell surface.
• Synonyms: GOLGIN-45; JEM-1; JEM-1s; JEM1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 93%

Reference Data

• Protein Families: Transcription Factors