ZNF157 Rabbit Polyclonal Antibody

SKU TA343402

Rabbit Polyclonal Anti-ZNF157 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF157 antibody: synthetic peptide directed towards the N terminal of human ZNF157. Synthetic peptide located within the following region: PANGTSPQRFPALIPGEPGRSFEGSVSFEDVAVDFTRQEWHRLDPAQRTM
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 58 kDa
• Gene Name: zinc finger protein 157
• Database Link:
  NP_003437
  P51786
• Background: ZNF157 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 12 C2H2-type zinc fingers and 1 KRAB domain. ZNF157 may be involved in transcriptional regulation. This gene product is a likely zinc finger family transcription factor. It contains KRAB-A and KRAB-B domains that act as transcriptional repressors in related proteins, and multiple zinc finger DNA binding motifs and finger linking regions characteristic of the Kruppel family. This gene is part of a gene cluster on chromosome Xp11.23. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-28 U28687.1 19-46 29-1620 BC075003.2 1-1592 1621-1695 CO245585.1 27-101 c
• Synonyms: HZF22
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Pig: 86%

Reference Data

• Protein Families: Transcription Factors