ZNF133 Rabbit Polyclonal Antibody

SKU
TA343397
Rabbit Polyclonal Anti-ZNF133 Antibody
$585.00
5 Days*
Specifications
Product Data
Application IF, WB
Recommended Dilution WB, IF
Reactivity Human, Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF133 antibody: synthetic peptide directed towards the middle region of human ZNF133. Synthetic peptide located within the following region: KPYVCKTCGRGFSLKSHLSRHRKTTSVHHRLPVQPDPEPCAGQPSDSLYS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 73 kDa
Gene Name zinc finger protein 133
Database Link
Background ZNF193 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 5 C2H2-type zinc fingers and 1 SCAN box domain. ZNF193 may be involved in transcriptional regulation.
Synonyms pHZ-13; pHZ-66; ZNF150
Note Immunogen Sequence Homology: Human: 100%; Pig: 77%; Rabbit: 77%
Reference Data
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:ZNF133 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.