ZNF74 Rabbit Polyclonal Antibody

SKU TA343391

Rabbit Polyclonal Anti-ZNF74 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNF74 antibody is: synthetic peptide directed towards the N-terminal region of Human ZNF74. Synthetic peptide located within the following region: VISHLERGEEPWSMQREVPRGPCPEWELKAVPSQQQGICKEEPAQEPIME
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 63 kDa
• Gene Name: zinc finger protein 74
• Database Link:
  NP_003417
  Q16587
• Background: ZNF74 contains 1 KRAB domain. The exact function of ZNF74 is not known.
• Synonyms: COS52; hZNF7; ZFP520; ZNF520
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Dog: 91%; Rabbit: 90%

Reference Data

• Protein Families: Transcription Factors