SMC6L1 (SMC6) Rabbit Polyclonal Antibody

SKU TA343360

Rabbit Polyclonal Anti-SMC6 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SMC6 antibody is: synthetic peptide directed towards the C-terminal region of Human SMC6. Synthetic peptide located within the following region: MADSQRFRQFILLTPQSMSSLPSSKLIRILRMSDPERGQTTLPFRPVTQE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 126 kDa
• Gene Name: structural maintenance of chromosomes 6
• Database Link:
  NP_078900
  Q96SB8
• Background: SMC6 is a core component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks.
• Synonyms: hSMC6; SMC-6; SMC6L1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%

Reference Data