Trophinin (TRO) Rabbit Polyclonal Antibody

SKU TA343304

Rabbit Polyclonal Anti-TRO Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRO antibody is: synthetic peptide directed towards the C-terminal region of Human TRO. Synthetic peptide located within the following region: EAEARAEIYSPCLQIPLINCSSPSHGAKVHPWNLCPHSSQGSYGQSAEGV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 33 kDa
• Gene Name: trophinin
• Database Link:
  NP_808225
  Q12816
• Background: This gene encodes a membrane protein that mediates cell adhesion between trophoblastic cells and the epithelial cells of the endometrium. The encoded protein participates in cell signalling during embryo implantation, and may also be involved in cancer formation. This gene is located near several other closely related genes on chromosome X. Alternative splicing results in multiple transcript variants.
• Synonyms: MAGE-d3; MAGED3
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data