NPB Rabbit Polyclonal Antibody

SKU TA343302

Rabbit Polyclonal Anti-NPB Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NPB antibody is: synthetic peptide directed towards the C-terminal region of NPB. Synthetic peptide located within the following region: PPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 14 kDa
• Gene Name: neuropeptide B
• Database Link:
  NP_683694
  Q8NG41
• Background: Neuropeptide B (NPB) is an endogenous peptide ligand for G protein-coupled receptor-7.
• Synonyms: L7; PPL7; PPNPB
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 90%; Dog: 79%; Bovine: 79%

Reference Data

• Protein Families: Secreted Protein, Transmembrane