NPB Rabbit Polyclonal Antibody

CAT#: TA343302

Rabbit Polyclonal Anti-NPB Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-NPB antibody is: synthetic peptide directed towards the C-terminal region of NPB. Synthetic peptide located within the following region: PPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 14 kDa
Gene Name neuropeptide B
Background Neuropeptide B (NPB) is an endogenous peptide ligand for G protein-coupled receptor-7.
Synonyms L7; PPL7; PPNPB
Note Immunogen Sequence Homology: Human: 100%; Rat: 90%; Dog: 79%; Bovine: 79%
Reference Data
Protein Families Secreted Protein, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.