VKORC1 Rabbit Polyclonal Antibody

SKU TA343292

Rabbit Polyclonal Anti-VKORC1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-VKORC1 antibody is: synthetic peptide directed towards the N-terminal region of VKORC1. Synthetic peptide located within the following region: LHVKAARARDRDYRALCDVGTAISCSRVFSSRLPADTLGLCPDAAELPGV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 10 kDa
• Gene Name: vitamin K epoxide reductase complex subunit 1
• Database Link:
  NP_996560
  Q9BQB6
• Background: Vitamin K is essential for blood clotting but must be enzymatically activated. This enzymatically activated form of vitamin K is a reduced form required for the carboxylation of glutamic acid residues in some blood-clotting proteins. The product of this gene encodes the enzyme that is responsible for reducing vitamin K 2,3-epoxide to the enzymatically activated form. Fatal bleeding can be caused by vitamin K deficiency and by the vitamin K antagonist warfarin, and it is the product of this gene that is sensitive to warfarin. In humans, mutations in this gene can be associated with deficiencies in vitamin-K-dependent clotting factors and, in humans and rats, with warfarin resistance. Two pseudogenes have been identified on chromosome 1 and the X chromosome. Two alternatively spliced transcripts encoding different isoforms have been described.
• Synonyms: EDTP308; MST134; MST576; VKCFD2; VKOR
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Rat: 86%; Mouse: 86%

Reference Data

• Protein Families: Transmembrane