NUPL1 (NUP58) Rabbit Polyclonal Antibody

SKU TA343254

Rabbit Polyclonal Anti-NUPL1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Rat
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Nupl1 antibody is: synthetic peptide directed towards the middle region of Rat Nupl1. Synthetic peptide located within the following region: GGIDFSTSSDKKSDKTGTRPEDSKALKDENLPPVICQDVENLQKFVKEQK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 64 kDa
• Gene Name: nucleoporin 58kDa
• Database Link:
  NP_054808
  Q9BVL2
• Background: Alternative splice products p58 and p45 are O-linked glycoprotein components of the nuclear pore p62 complex and may play a role in nuclear protein import.
• Synonyms: NUP45; NUPL1; PRO2463
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data