DHTKD1 Rabbit Polyclonal Antibody

SKU TA343242

Rabbit Polyclonal Anti-DHTKD1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DHTKD1 antibody is: synthetic peptide directed towards the N-terminal region of Human DHTKD1. Synthetic peptide located within the following region: YCGQISIETSQLQSQDEKDWFAKRFEELQKETFTTEERKHLSKLMLESQE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 102 kDa
• Gene Name: dehydrogenase E1 and transketolase domain containing 1
• Database Link:
  NP_061176
  Q96HY7
• Background: The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO2. It contains multiple copies of three enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3).
• Synonyms: AMOXAD; CMT2Q
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Rat: 86%; Guinea pig: 86%; Mouse: 79%

Reference Data