BAAT1 (BRAT1) Rabbit Polyclonal Antibody

CAT#: TA343238

Rabbit Polyclonal Anti-BRAT1 Antibody

Product Images

WB Suggested Anti-BRAT1 Antibody; Titration: 1.0 ug/ml; Positive Control: HepG2 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BRAT1 antibody is: synthetic peptide directed towards the C-terminal region of Human BRAT1. Synthetic peptide located within the following region: FDCDRPVAQKSCDLLLFLRDKIASYSSLREARGSPNTASAEATLPRWRAG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 87 kDa
• Gene Name: BRCA1 associated ATM activator 1
• Database Link:
  NP_689956
  Entrez Gene 221927 Human
  UniProt ID Q6PJG6
• Background: The protein encoded by this ubiquitously expressed gene interacts with the tumor suppressing BRCA1 (breast cancer 1) protein and and the ATM (ataxia telangiectasia mutated) protein. ATM is thought to be a master controller of cell cycle checkpoint signalling pathways that are required for cellular responses to DNA damage such as double-strand breaks that are induced by ionizing radiation and complexes with BRCA1 in the multi-protein complex BASC (BRAC1-associated genome surveillance complex). The protein encoded by this gene is thought to play a role in the DNA damage pathway regulated by BRCA1 and ATM.
• Synonyms: BAAT1; C7orf27; RMFSL
• Note: Immunogen Sequence Homology: Human: 100%