MED29 Rabbit Polyclonal Antibody

CAT#: TA343222

Rabbit Polyclonal Anti-MED29 Antibody

Product Images

Host: Rabbit; Target Name: Med29; Sample Tissue: Mouse Liver lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Med29 antibody is: synthetic peptide directed towards the middle region of Mouse Med29. Synthetic peptide located within the following region: LQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: mediator complex subunit 29
• Database Link:
  NP_060062
  Entrez Gene 67224 Mouse
  UniProt ID Q9NX70
• Background: Med29 is a component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. It mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
• Synonyms: IXL
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 79%