FUCA2 Rabbit Polyclonal Antibody

CAT#: TA343213

Rabbit Polyclonal Anti-FUCA2 Antibody

Product Images

Host: Rabbit; Target Name: Fuca2; Sample Tissue: Mouse Heart lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Fuca2 antibody is: synthetic peptide directed towards the middle region of Mouse Fuca2. Synthetic peptide located within the following region: SKTLPELYELVNRYQPEVLWSDGDGGAPDHYWNSTGFLAWLYNESPVRKT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: fucosidase, alpha-L- 2, plasma
• Database Link:
  NP_114409
  Entrez Gene 66848 Mouse
  UniProt ID Q9BTY2
• Background: Alpha-L-fucosidase is responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins.
• Synonyms: dJ20N2.5
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 93%; Pig: 92%; Horse: 92%; Bovine: 92%; Zebrafish: 92%; Guinea pig: 92%; Dog

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Other glycan degradation