VPS33A Rabbit Polyclonal Antibody

CAT#: TA343192

Rabbit Polyclonal Anti-VPS33A Antibody

Product Images

Host: Rabbit; Target Name: VPS33A; Sample Tissue: 721_B whole cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-VPS33A antibody is: synthetic peptide directed towards the middle region of Human VPS33A. Synthetic peptide located within the following region: TYEGLIDEIYGIQNSYVKLPPEKFAPKKQGDGGKDLPTEAKKLQLNSAEE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 67 kDa
• Gene Name: VPS33A, CORVET/HOPS core subunit
• Database Link:
  NP_075067
  Entrez Gene 65082 Human
  UniProt ID Q96AX1
• Background: Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene is a member of the Sec-1 domain family, and it encodes a protein similar to the yeast class C Vps33 protein. The mammalian class C VPS proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway.
• Synonyms: FLJ22395; FLJ23187
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 86%; Mouse: 81%