ASAH3 (ACER1) Rabbit Polyclonal Antibody

CAT#: TA343069

Rabbit Polyclonal Anti-ACER1 Antibody

Product Images

WB Suggested Anti-ACER1 Antibody; Titration: 1.0 ug/ml; Positive Control: HCT15 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACER1 antibody: synthetic peptide directed towards the C terminal of human ACER1. Synthetic peptide located within the following region: VNAYALNSIALHILYIVCQEYRKTSNKELRHLIEVSVVLWAVALTSWISD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: alkaline ceramidase 1
• Database Link:
  NP_597999
  Entrez Gene 125981 Human
  UniProt ID Q8TDN7
• Background: ACER1 hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid at an optimal pH of 8.0. It has a highly restricted substrate specificity for the natural stereoisomer of ceramide with D-erythro-sphingosine but not D-ribo-phytosphingosine or D-erythro-dihydrosphingosine as a backbone. It may have a role in regulating the levels of bioactive lipids ceramide and sphingosine 1-phosphate, as well as complex sphingolipids.
• Synonyms: ALKCDase1; ASAH3
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 92%; Rabbit: 86%; Pig: 85%; Bovine: 79%; Rat; Guinea pig: 75%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Metabolic pathways, Sphingolipid metabolism