AMACR Rabbit Polyclonal Antibody

CAT#: TA343068

Rabbit Polyclonal Anti-AMACR Antibody

Product Images

AMACR antibody validated by WB using 721_B cell lysate at 1.0 ug/ml. AMACR is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

• 

  Immunohistochemistry with Kidney tissue at an antibody concentration of 5 ug/ml using anti-AMACR antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AMACR antibody: synthetic peptide directed towards the C terminal of human AMACR. Synthetic peptide located within the following region: IFDGTDACVTPVLTFEEVVHHDHNKERGSFITSEEQDVSPRPAPLLLNTP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: alpha-methylacyl-CoA racemase
• Database Link:
  NP_055139
  Entrez Gene 23600 Human
  UniProt ID Q9UHK6
• Background: This gene encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers. The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation. Encoded proteins from this locus localize to both mitochondria and peroxisomes. Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, pigmentary retinopathy, and adrenomyeloneuropathy due to defects in bile acid synthesis. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene.
• Synonyms: AMACRD; CBAS4; RACE; RM
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 85%; Rat: 85%; Horse: 85%; Bovine: 85%; Rabbit: 82%; Mouse; Guinea pig

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Primary bile acid biosynthesis