AMACR Rabbit Polyclonal Antibody

CAT#: TA343068

Reviews ()
Write a review

Rabbit Polyclonal Anti-AMACR Antibody


 Product Datasheet for 'TA343068'

USD 360.00


Availability*
2 Weeks

Size
    • 100 ul


Product images

Specifications

Product Data
Clone Name Polyclonal
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-AMACR antibody: synthetic peptide directed towards the C terminal of human AMACR. Synthetic peptide located within the following region: IFDGTDACVTPVLTFEEVVHHDHNKERGSFITSEEQDVSPRPAPLLLNTP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Predicted Protein Size 42 kDa
Gene Name alpha-methylacyl-CoA racemase
Background This gene encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers. The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation. Encoded proteins from this locus localize to both mitochondria and peroxisomes. Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, pigmentary retinopathy, and adrenomyeloneuropathy due to defects in bile acid synthesis. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene.
Synonyms AMACRD; CBAS4; RACE; RM
Note Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 85%; Rat: 85%; Horse: 85%; Bovine: 85%; Rabbit: 82%; Mouse; Guinea pig
Reference Data
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Primary bile acid biosynthesis
Other products for "AMACR"
Frequently bought together (2)
Transient overexpression lysate of alpha-methylacyl-CoA racemase (AMACR), nuclear gene encoding mitochondrial protein, transcript variant 1
    • 100 ug

USD 315.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
40% off proteins and antibodies
68 Mouse Clones