FGFBP2 Rabbit Polyclonal Antibody

CAT#: TA342998

Rabbit Polyclonal Anti-FGFBP2 Antibody

Product Images

WB Suggested Anti-FGFBP2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FGFBP2 antibody: synthetic peptide directed towards the C terminal of human FGFBP2. Synthetic peptide located within the following region: LGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALCAFLISFF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: fibroblast growth factor binding protein 2
• Database Link:
  NP_114156
  Entrez Gene 83888 Human
  UniProt ID Q9BYJ0
• Background: FGFBP2 is a member of the fibroblast growth factor binding protein family. The encoded protein is a serum protein that is selectively secreted by cytotoxic lymphocytes and may be involved in cytotoxic lymphocyte-mediated immunity. An increase in the amount of gene product may be associated with atopic asthma and mild extrinsic asthma.
• Synonyms: HBP17RP; KSP37
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Secreted Protein