TM2D2 Rabbit Polyclonal Antibody

SKU TA342997

Rabbit Polyclonal Anti-TM2D2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TM2D2 antibody: synthetic peptide directed towards the middle region of human TM2D2. Synthetic peptide located within the following region: QELGYGCLKFGGQAYSDVEHTSVQCHALDGIECASPRTFLRENKPCIKYT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 23 kDa
• Gene Name: TM2 domain containing 2
• Database Link:
  NP_510882
  Q9BX73
• Background: The protein encoded by this gene contains a structural module related to that of the seven transmembrane domain G protein-coupled receptor superfamily. This protein has sequence and structural similarities to the beta-amyloid binding protein (BBP), but, unlike BBP, it does not regulate a response to beta-amyloid peptide. This protein may have regulatory roles in cell death or proliferation signal cascades.
• Synonyms: BLP1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Goat: 92%; Horse: 92%; Mouse: 92%; Bovine: 92%; Zebrafish

Reference Data

• Protein Families: Druggable Genome, Transmembrane