RHBDD1 Rabbit Polyclonal Antibody

SKU
TA342970
Rabbit Polyclonal Anti-RHBDD1 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RHBDD1 antibody: synthetic peptide directed towards the C terminal of human RHBDD1. Synthetic peptide located within the following region: PDHYEEAPRNYDTYTAGLSEEEQLERALQASLWDRGNTRNSPPPYGFHLS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 36 kDa
Gene Name rhomboid domain containing 1
Database Link
Background The function of this protein remains unknown.
Synonyms RRP4
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 86%; Yeast: 85%; Pig: 79%; Guinea pig: 79%
Reference Data
Protein Families Transmembrane
Write Your Own Review
You're reviewing:RHBDD1 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.