FYTTD1 Rabbit Polyclonal Antibody

SKU TA342955

Rabbit Polyclonal Anti-FYTTD1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Rat
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Fyttd1 antibody is: synthetic peptide directed towards the middle region of Rat Fyttd1. Synthetic peptide located within the following region: TEQLIDDVVAKRTRQTQKPRLTRTAVPSFLTKREQSDVKKIPKGVPLQFD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 20 kDa
• Gene Name: forty-two-three domain containing 1
• Database Link:
  NP_115664
  Q96QD9
• Background: Fyttd1 is required for mRNA export from the nucleus to the cytoplasm. It acts as an adapter that uses the DDX39B/UAP56-NFX1 pathway to ensure efficient mRNA export and delivering to the nuclear pore. Fyttd1 associates with spliced and unspliced mRNAs simultaneously with ALYREF/THOC4.
• Synonyms: UIF
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Horse: 93%; Rabbit: 93%; Bovine: 86%

Reference Data