RBED1 (ELMOD3) Rabbit Polyclonal Antibody

SKU TA342950

Rabbit Polyclonal Anti-ELMOD3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ELMOD3 antibody: synthetic peptide directed towards the C terminal of human ELMOD3. Synthetic peptide located within the following region: FRLSRHHIQQFPFCLMSVNITHIAIQALREECLSRECNRQQKVIPVVNSF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 44 kDa
• Gene Name: ELMO domain containing 3
• Database Link:
  NP_115589
  Q96FG2
• Background: ELMOD3 lacks GTPase-activating protein (GAP) toward guanine nucleotide exchange factor ARL2.
• Synonyms: DFNB88; LST3; RBED1; RBM29
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%; Guinea pig: 93%

Reference Data