SPRED2 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-SPRED2 antibody: synthetic peptide directed towards the C terminal of human SPRED2. Synthetic peptide located within the following region: NHEENRRGHCQDAPDSVRTCIRRVSCMWCADSMLYHCMSDPEGDYTDPCS |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 47 kDa |
| Gene Name | sprouty related EVH1 domain containing 2 |
| Database Link | |
| Background | SPRED2 is a member of the Sprouty /SPRED family of proteins that regulate growth factor-induced activation of the MAP kinase cascade . |
| Synonyms | Spred-2 |
| Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Dog: 92%; Zebrafish: 85% |
| Reference Data | |
| Protein Categories | Growth Factors, Intracellular Proteins, Membrane Proteins |
| Protein Pathways | Jak-STAT signaling pathway |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
Expression of Spred2 in the urothelial tumorigenesis of the urinary bladder
Oda, Fujisawa, Chunning et al
PLoS One (2021) 16 (11), e0254289 DOI: 10.1371/journal.pone.0254289
Oda, Fujisawa, Chunning et al
PLoS One (2021) 16 (11), e0254289 DOI: 10.1371/journal.pone.0254289
Cited by 5
AI Summary: OriGene products contributed to this study by providing the anti-Spred2 antibody (Cat# TA325157) used for immunohistochemical detection of Spred2 protein expression in urothelial tumor tissue samples.
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
