Netrin G2 (NTNG2) Rabbit Polyclonal Antibody

SKU TA342923

Rabbit Polyclonal Anti-NTNG2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NTNG2 antibody: synthetic peptide directed towards the middle region of human NTNG2. Synthetic peptide located within the following region: YSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNMDNLYTRLESAKGLKEFFT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 60 kDa
• Gene Name: netrin G2
• Database Link:
  NP_115925
  Q96CW9
• Background: NTNG2 promotes neurite outgrowth of both axons and dendrites.
• Synonyms: bA479K20.1; LHLL9381; Lmnt2; NTNG1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 79%

Reference Data