MGST3 Rabbit Polyclonal Antibody

CAT#: TA342918

Rabbit Polyclonal Anti-MGST3 Antibody

Product Images

WB Suggested Anti-MGST3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MGST3 antibody: synthetic peptide directed towards the N terminal of human MGST3. Synthetic peptide located within the following region: LAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 16 kDa
• Gene Name: microsomal glutathione S-transferase 3
• Database Link:
  NP_004519
  Entrez Gene 4259 Human
  UniProt ID O14880
• Background: The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, several of which are involved the production of leukotrienes and prostaglandin E, important mediators of inflammation. MAPEG is an enzyme which catalyzes the conjugation of leukotriene A4 and reduced glutathione to produce leukotriene C4. This enzyme also demonstrates glutathione-dependent peroxidase activity towards lipid hydroperoxides.
• Synonyms: GST-III
• Note: Immunogen Sequence Homology: Rat: 100%; Goat: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450