MAP3K12 binding inhibitory protein 1 (MBIP) Rabbit Polyclonal Antibody

SKU
TA342912
Rabbit Polyclonal Anti-MBIP Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MBIP antibody is: synthetic peptide directed towards the C-terminal region of Human MBIP. Synthetic peptide located within the following region: FQSVSFSGKRRKVQPPQQNYSLAELDEKISALKQALLRKSREAESMATHH
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 39 kDa
Gene Name MAP3K12 binding inhibitory protein 1
Database Link
Background MBIP inhibits the MAP3K12 activity to induce the activation of the JNK/SAPK pathway. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.
Synonyms MAP3K12 binding inhibitory protein 1; MUK-binding inhibitory protein; OTTHUMP00000178844
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Bovine: 93%; Rat: 86%; Mouse: 86%; Rabbit: 86%
Reference Data
Write Your Own Review
You're reviewing:MAP3K12 binding inhibitory protein 1 (MBIP) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.