IL1F10 Rabbit Polyclonal Antibody

CAT#: TA342892

Rabbit Polyclonal Anti-IL1F10 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human interleukin 1 family, member 10 (theta) (IL1F10), transcript variant 1, 20 µg
    • 20 ug

USD 867.00


Transient overexpression lysate of interleukin 1 family, member 10 (theta) (IL1F10), transcript variant 2
    • 100 ug

USD 436.00

Other products for "IL1F10"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-IL1F10 antibody: synthetic peptide directed towards the middle region of human IL1F10. Synthetic peptide located within the following region: SRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 17 kDa
Gene Name interleukin 1 family member 10 (theta)
Background The protein encoded by this gene is a member of the interleukin 1 cytokine family. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. This cytokine is thought to participate in a network of interleukin 1 family members to regulate adapted and innate immune responses.
Synonyms FIL1-theta; FKSG75; IL-1HY2; IL-38; IL1-theta; IL1HY2
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%
Reference Data
Protein Families Druggable Genome, Secreted Protein

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.