TMIGD3 Rabbit Polyclonal Antibody

SKU TA342793

Rabbit Polyclonal Anti-ADORA3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ADORA3 antibody: synthetic peptide directed towards the C terminal of human ADORA3. Synthetic peptide located within the following region: DFTELIVTDDKGTLANDFWSGKDLSGNKTRSCKAPKVVRKADRSRTSILI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 39 kDa
• Gene Name: transmembrane and immunoglobulin domain containing 3
• Database Link:
  NP_065734
  P0DMS9
• Background: This gene encodes a protein that belongs to the family of adenosine receptors, which are G-protein-coupled receptors that are involved in a variety of intracellular signaling pathways and physiological functions. The receptor encoded by this gene mediates a sustained cardioprotective function during cardiac ischemia, it is involved in the inhibition of neutrophil degranulation in neutrophil-mediated tissue injury, it has been implicated in both neuroprotective and neurodegenerative effects, and it may also mediate both cell proliferation and cell death.
• Synonyms: AD026
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 79%; Bovine: 79%

Reference Data