MAGEL2 Rabbit Polyclonal Antibody

SKU TA342770

Rabbit Polyclonal Anti-MAGEL2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MAGEL2 antibody: synthetic peptide directed towards the N terminal of human MAGEL2. Synthetic peptide located within the following region: MQGLFYRPQGSSKERRTSSKERRAPSKDRMIFAATFCAPKAVSAARAHLP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 58 kDa
• Gene Name: MAGE family member L2
• Database Link:
  NP_061939
  Q9UJ55
• Background: Prader-Willi syndrome (PWS) is caused by the loss of expression of imprinted genes in chromosome 15q11-q13 region. Affected individuals exhibit neonatal hypotonia, developmental delay, and childhood-onset obesity. Necdin (NDN), a gene involved in the terminal differentiation of neurons, localizes to this region of the genome and has been implicated as one of the genes responsible for the etiology of PWS. This gene is structurally similar to NDN, is also localized to the PWS chromosomal region, and is paternally imprinted, suggesting a possible role for it in PWS.
• Synonyms: NDNL1; nM15; PWLS; SHFYNG
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Rabbit: 100%; Pig: 88%; Bovine: 83%

Reference Data