ENOX2 Rabbit Polyclonal Antibody

SKU
TA342764
Rabbit Polyclonal Anti-ENOX2 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ENOX2 antibody: synthetic peptide directed towards the N terminal of human ENOX2. Synthetic peptide located within the following region: YRIRLGSSTDKKDTGRLHVDFAQARDDLYEWECKQRMLAREERHRRRMEE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 66 kDa
Gene Name ecto-NOX disulfide-thiol exchanger 2
Database Link
Background The protein encoded by this gene is a growth-related cell surface protein. It was identifed because it reacts with the monoclonal antibody KI in cells, such as the ovarian carcinoma line OVCAR-3, also expressing the CAKI surface glycoprotein. The encoded protein has two enzymatic activities: catalysis of hydroquinone or NADH oxidation, and protein disulfide interchange. The two activities alternate with a period length of about 24 minutes. The encoded protein also displays prion-like properties. Two transcript variants encoding different isoforms have been found for this gene.
Synonyms APK1; COVA1; tNOX
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Bovine: 93%
Reference Data
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:ENOX2 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.