SLX4 Rabbit Polyclonal Antibody

CAT#: TA342761

Rabbit Polyclonal Anti-SLX4 Antibody

Product Images

WB Suggested Anti-BTBD12 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: ACHN cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BTBD12 antibody: synthetic peptide directed towards the N terminal of human BTBD12. Synthetic peptide located within the following region: TKTLQGPAEKKPPSGSQAPRTKKQRVTKWQASEPAHSVNGEGGVLASAPD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 200 kDa
• Gene Name: SLX4 structure-specific endonuclease subunit
• Database Link:
  NP_115820
  Entrez Gene 84464 Human
  UniProt ID Q8IY92
• Background: This gene encodes a structure-specific endonuclease subunit. The encoded protein contains a central BTB domain and it forms a multiprotein complex with the ERCC4(XPF)-ERCC1, MUS81-EME1, and SLX1 endonucleases, and also associates with MSH2/MSH3 mismatch repair complex, telomere binding complex TERF2(TRF2)-TERF2IP(RAP1), the protein kinase PLK1 and the uncharacterized protein C20orf94. The multiprotein complex is required for repair of specific types of DNA lesions and is critical for cellular responses to replication fork failure. The encoded protein acts as a docking platform for the assembly of multiple structure-specific endonucleases.
• Synonyms: BTBD12; FANCP; MUS312
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 91%